Add Helm metadata to GraphQL

Changelog: added

app/graphql/types/packages/file_metadata_type.rb

@@ -14,6 +14,8 @@ module Types
         case object
         when ::Packages::Conan::FileMetadatum
           ::Types::Packages::Conan::FileMetadatumType
+        when ::Packages::Helm::FileMetadatum
+          ::Types::Packages::Helm::FileMetadatumType
         else
           # NOTE: This method must be kept in sync with `PackageFileType#file_metadata`,
           # which must never produce data that this discriminator cannot handle.
@@ -21,7 +23,8 @@ module Types
         end
       end
 
-      orphan_types Types::Packages::Conan::FileMetadatumType
+      orphan_types Types::Packages::Conan::FileMetadatumType,
+                   Types::Packages::Helm::FileMetadatumType
     end
   end
 end

app/graphql/types/packages/helm/dependency_type.rb

+# frozen_string_literal: true
+
+module Types
+  module Packages
+    module Helm
+      # rubocop: disable Graphql/AuthorizeTypes
+      class DependencyType < BaseObject
+        graphql_name 'PackageHelmDependencyType'
+        description 'Represents a Helm dependency'
+
+        # Need to be synced with app/validators/json_schemas/helm_metadata.json#dependencies
+        field :name, GraphQL::Types::String, null: true, description: 'Name of the dependency.'
+        field :version, GraphQL::Types::String, null: true, description: 'Version of the dependency.'
+        field :repository, GraphQL::Types::String, null: true, description: 'Repository of the dependency.'
+        field :condition, GraphQL::Types::String, null: true, description: 'Condition of the dependency.'
+        field :tags, [GraphQL::Types::String], null: true, description: 'Tags of the dependency.'
+        field :enabled, GraphQL::Types::Boolean, null: true, description: 'Indicates the dependency is enabled.'
+        field :import_values, [GraphQL::Types::JSON], null: true, description: 'Import-values of the dependency.', hash_key: "import-values" # rubocop:disable Graphql/JSONType
+        field :alias, GraphQL::Types::String, null: true, description: 'Alias of the dependency.', resolver_method: :resolve_alias
+
+        # field :alias` conflicts with a built-in method
+        def resolve_alias
+          object['alias']
+        end
+      end
+    end
+  end
+end

app/graphql/types/packages/helm/file_metadatum_type.rb

+# frozen_string_literal: true
+
+module Types
+  module Packages
+    module Helm
+      class FileMetadatumType < BaseObject
+        graphql_name 'HelmFileMetadata'
+        description 'Helm file metadata'
+
+        implements Types::Packages::FileMetadataType
+
+        authorize :read_package
+
+        field :channel, GraphQL::Types::String, null: false, description: 'Channel of the Helm chart.'
+        field :metadata, Types::Packages::Helm::MetadataType, null: false, description: 'Metadata of the Helm chart.'
+      end
+    end
+  end
+end

app/graphql/types/packages/helm/maintainer_type.rb

+# frozen_string_literal: true
+
+module Types
+  module Packages
+    module Helm
+      # rubocop: disable Graphql/AuthorizeTypes
+      class MaintainerType < BaseObject
+        graphql_name 'PackageHelmMaintainerType'
+        description 'Represents a Helm maintainer'
+
+        # Need to be synced with app/validators/json_schemas/helm_metadata.json#maintainers
+        field :name, GraphQL::Types::String, null: true, description: 'Name of the maintainer.'
+        field :email, GraphQL::Types::String, null: true, description: 'Email of the maintainer.'
+        field :url, GraphQL::Types::String, null: true, description: 'URL of the maintainer.'
+      end
+    end
+  end
+end

app/graphql/types/packages/helm/metadata_type.rb

+# frozen_string_literal: true
+
+module Types
+  module Packages
+    module Helm
+      # rubocop: disable Graphql/AuthorizeTypes
+      class MetadataType < BaseObject
+        graphql_name 'PackageHelmMetadataType'
+        description 'Represents the contents of a Helm Chart.yml file'
+
+        # Need to be synced with app/validators/json_schemas/helm_metadata.json
+        field :name, GraphQL::Types::String, null: false, description: 'Name of the chart.'
+        field :home, GraphQL::Types::String, null: true, description: 'URL of the home page.'
+        field :sources, [GraphQL::Types::String], null: true, description: 'URLs of the source code for the chart.'
+        field :version, GraphQL::Types::String, null: false, description: 'Version of the chart.'
+        field :description, GraphQL::Types::String, null: true, description: 'Description of the chart.'
+        field :keywords, [GraphQL::Types::String], null: true, description: 'Keywords for the chart.'
+        field :maintainers, [Types::Packages::Helm::MaintainerType], null: true, description: 'Maintainers of the chart.'
+        field :icon, GraphQL::Types::String, null: true, description: 'URL to an SVG or PNG image for the chart.'
+        field :api_version, GraphQL::Types::String, null: false, description: 'API version of the chart.', hash_key: "apiVersion"
+        field :condition, GraphQL::Types::String, null: true, description: 'Condition for the chart.'
+        field :tags, GraphQL::Types::String, null: true, description: 'Tags for the chart.'
+        field :app_version, GraphQL::Types::String, null: true, description: 'App version of the chart.', hash_key: "appVersion"
+        field :deprecated, GraphQL::Types::Boolean, null: true, description: 'Indicates if the chart is deprecated.'
+        field :annotations, GraphQL::Types::JSON, null: true, description: 'Annotations for the chart.' # rubocop:disable Graphql/JSONType
+        field :kube_version, GraphQL::Types::String, null: true, description: 'Kubernetes versions for the chart.', hash_key: "kubeVersion"
+        field :dependencies, [Types::Packages::Helm::DependencyType], null: true, description: 'Dependencies of the chart.'
+        field :type, GraphQL::Types::String, null: true, description: 'Type of the chart.', hash_key: "appVersion"
+      end
+    end
+  end
+end

app/graphql/types/packages/package_file_type.rb

@@ -27,6 +27,8 @@ module Types
         case object.package.package_type
         when 'conan'
           object.conan_file_metadatum
+        when 'helm'
+          object.helm_file_metadatum
         else
           nil
         end

app/policies/packages/helm/file_metadatum_policy.rb

+# frozen_string_literal: true
+module Packages
+  module Helm
+    class FileMetadatumPolicy < BasePolicy
+      delegate { @subject.package_file.package }
+    end
+  end
+end

app/validators/json_schemas/helm_metadata.json

@@ -103,7 +103,23 @@
           "import-values": {
             "type": "array",
             "items": {
-
+              "oneOf": [
+                {
+                  "type": "string"
+                },
+                {
+                  "type": "object",
+                  "properties": {
+                    "child": {
+                      "type": "string"
+                    },
+                    "parent": {
+                      "type": "string"
+                    }
+                  },
+                  "additionalProperties": false
+                }
+              ]
             }
           },
           "alias": {

doc/api/graphql/reference/index.md

@@ -10911,6 +10911,19 @@ Represents the Geo sync and verification state of a group wiki repository.
 | <a id="groupwikirepositoryregistryretrycount"></a>`retryCount` | [`Int`](#int) | Number of consecutive failed sync attempts of the GroupWikiRepositoryRegistry. |
 | <a id="groupwikirepositoryregistrystate"></a>`state` | [`RegistryState`](#registrystate) | Sync state of the GroupWikiRepositoryRegistry. |
 
+### `HelmFileMetadata`
+
+Helm file metadata.
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="helmfilemetadatachannel"></a>`channel` | [`String!`](#string) | Channel of the Helm chart. |
+| <a id="helmfilemetadatacreatedat"></a>`createdAt` | [`Time!`](#time) | Date of creation. |
+| <a id="helmfilemetadatametadata"></a>`metadata` | [`PackageHelmMetadataType!`](#packagehelmmetadatatype) | Metadata of the Helm chart. |
+| <a id="helmfilemetadataupdatedat"></a>`updatedAt` | [`Time!`](#time) | Date of most recent update. |
+
 ### `IncidentManagementOncallRotation`
 
 Describes an incident management on-call rotation.
@@ -12381,6 +12394,61 @@ Represents the Geo sync and verification state of a package file.
 | <a id="packagefileregistryretrycount"></a>`retryCount` | [`Int`](#int) | Number of consecutive failed sync attempts of the PackageFileRegistry. |
 | <a id="packagefileregistrystate"></a>`state` | [`RegistryState`](#registrystate) | Sync state of the PackageFileRegistry. |
 
+### `PackageHelmDependencyType`
+
+Represents a Helm dependency.
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="packagehelmdependencytypealias"></a>`alias` | [`String`](#string) | Alias of the dependency. |
+| <a id="packagehelmdependencytypecondition"></a>`condition` | [`String`](#string) | Condition of the dependency. |
+| <a id="packagehelmdependencytypeenabled"></a>`enabled` | [`Boolean`](#boolean) | Indicates the dependency is enabled. |
+| <a id="packagehelmdependencytypeimportvalues"></a>`importValues` | [`[JSON!]`](#json) | Import-values of the dependency. |
+| <a id="packagehelmdependencytypename"></a>`name` | [`String`](#string) | Name of the dependency. |
+| <a id="packagehelmdependencytyperepository"></a>`repository` | [`String`](#string) | Repository of the dependency. |
+| <a id="packagehelmdependencytypetags"></a>`tags` | [`[String!]`](#string) | Tags of the dependency. |
+| <a id="packagehelmdependencytypeversion"></a>`version` | [`String`](#string) | Version of the dependency. |
+
+### `PackageHelmMaintainerType`
+
+Represents a Helm maintainer.
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="packagehelmmaintainertypeemail"></a>`email` | [`String`](#string) | Email of the maintainer. |
+| <a id="packagehelmmaintainertypename"></a>`name` | [`String`](#string) | Name of the maintainer. |
+| <a id="packagehelmmaintainertypeurl"></a>`url` | [`String`](#string) | URL of the maintainer. |
+
+### `PackageHelmMetadataType`
+
+Represents the contents of a Helm Chart.yml file.
+
+#### Fields
+
+| Name | Type | Description |
+| ---- | ---- | ----------- |
+| <a id="packagehelmmetadatatypeannotations"></a>`annotations` | [`JSON`](#json) | Annotations for the chart. |
+| <a id="packagehelmmetadatatypeapiversion"></a>`apiVersion` | [`String!`](#string) | API version of the chart. |
+| <a id="packagehelmmetadatatypeappversion"></a>`appVersion` | [`String`](#string) | App version of the chart. |
+| <a id="packagehelmmetadatatypecondition"></a>`condition` | [`String`](#string) | Condition for the chart. |
+| <a id="packagehelmmetadatatypedependencies"></a>`dependencies` | [`[PackageHelmDependencyType!]`](#packagehelmdependencytype) | Dependencies of the chart. |
+| <a id="packagehelmmetadatatypedeprecated"></a>`deprecated` | [`Boolean`](#boolean) | Indicates if the chart is deprecated. |
+| <a id="packagehelmmetadatatypedescription"></a>`description` | [`String`](#string) | Description of the chart. |
+| <a id="packagehelmmetadatatypehome"></a>`home` | [`String`](#string) | URL of the home page. |
+| <a id="packagehelmmetadatatypeicon"></a>`icon` | [`String`](#string) | URL to an SVG or PNG image for the chart. |
+| <a id="packagehelmmetadatatypekeywords"></a>`keywords` | [`[String!]`](#string) | Keywords for the chart. |
+| <a id="packagehelmmetadatatypekubeversion"></a>`kubeVersion` | [`String`](#string) | Kubernetes versions for the chart. |
+| <a id="packagehelmmetadatatypemaintainers"></a>`maintainers` | [`[PackageHelmMaintainerType!]`](#packagehelmmaintainertype) | Maintainers of the chart. |
+| <a id="packagehelmmetadatatypename"></a>`name` | [`String!`](#string) | Name of the chart. |
+| <a id="packagehelmmetadatatypesources"></a>`sources` | [`[String!]`](#string) | URLs of the source code for the chart. |
+| <a id="packagehelmmetadatatypetags"></a>`tags` | [`String`](#string) | Tags for the chart. |
+| <a id="packagehelmmetadatatypetype"></a>`type` | [`String`](#string) | Type of the chart. |
+| <a id="packagehelmmetadatatypeversion"></a>`version` | [`String!`](#string) | Version of the chart. |
+
 ### `PackageSettings`
 
 Namespace-level Package Registry settings.
@@ -17759,6 +17827,7 @@ Represents metadata associated with a Package file.
 Implementations:
 
 - [`ConanFileMetadata`](#conanfilemetadata)
+- [`HelmFileMetadata`](#helmfilemetadata)
 
 ##### Fields
 

spec/factories/packages/helm/file_metadatum.rb

@@ -9,7 +9,11 @@ FactoryBot.define do
     package_file { association(:helm_package_file, without_loaded_metadatum: true) }
     sequence(:channel) { |n| "#{FFaker::Lorem.word}-#{n}" }
     metadata do
-      { 'name': package_file.package.name, 'version': package_file.package.version, 'apiVersion': 'v2' }.tap do |defaults|
+      {
+        'name': package_file.package.name,
+        'version': package_file.package.version,
+        'apiVersion': 'v2'
+      }.tap do |defaults|
         defaults['description'] = description if description
       end
     end

spec/fixtures/api/schemas/graphql/packages/package_details.json

@@ -12,7 +12,6 @@
     "tags",
     "pipelines",
     "versions",
-    "metadata",
     "status",
     "canDestroy"
   ],
@@ -47,7 +46,8 @@
         "GENERIC",
         "GOLANG",
         "RUBYGEMS",
-        "DEBIAN"
+        "DEBIAN",
+        "HELM"
       ]
     },
     "tags": {

spec/graphql/types/packages/helm/dependency_type_spec.rb

+# frozen_string_literal: true
+
+require 'spec_helper'
+
+RSpec.describe GitlabSchema.types['PackageHelmDependencyType'] do
+  it { expect(described_class.graphql_name).to eq('PackageHelmDependencyType') }
+
+  it 'includes helm dependency fields' do
+    expected_fields = %w[
+      name version repository condition tags enabled import_values alias
+    ]
+
+    expect(described_class).to include_graphql_fields(*expected_fields)
+  end
+end

spec/graphql/types/packages/helm/file_metadatum_type_spec.rb

+# frozen_string_literal: true
+
+require 'spec_helper'
+
+RSpec.describe GitlabSchema.types['HelmFileMetadata'] do
+  it { expect(described_class.graphql_name).to eq('HelmFileMetadata') }
+
+  it 'includes helm file metadatum fields' do
+    expected_fields = %w[
+      created_at updated_at channel metadata
+    ]
+
+    expect(described_class).to include_graphql_fields(*expected_fields)
+  end
+end

spec/graphql/types/packages/helm/maintainer_type_spec.rb

+# frozen_string_literal: true
+
+require 'spec_helper'
+
+RSpec.describe GitlabSchema.types['PackageHelmMaintainerType'] do
+  it { expect(described_class.graphql_name).to eq('PackageHelmMaintainerType') }
+
+  it 'includes helm maintainer fields' do
+    expected_fields = %w[
+      name email url
+    ]
+
+    expect(described_class).to include_graphql_fields(*expected_fields)
+  end
+end

spec/graphql/types/packages/helm/metadata_type_spec.rb

+# frozen_string_literal: true
+
+require 'spec_helper'
+
+RSpec.describe GitlabSchema.types['PackageHelmMetadataType'] do
+  it { expect(described_class.graphql_name).to eq('PackageHelmMetadataType') }
+
+  it 'includes helm json fields' do
+    expected_fields = %w[
+      name home sources version description keywords maintainers icon apiVersion condition tags appVersion deprecated annotations kubeVersion dependencies type
+    ]
+
+    expect(described_class).to include_graphql_fields(*expected_fields)
+  end
+end

spec/requests/api/graphql/packages/helm_spec.rb

+# frozen_string_literal: true
+require 'spec_helper'
+
+RSpec.describe 'helm package details' do
+  include GraphqlHelpers
+  include_context 'package details setup'
+
+  let_it_be(:package) { create(:helm_package, project: project) }
+
+  let(:package_files_metadata) {query_graphql_fragment('HelmFileMetadata')}
+
+  let(:query) do
+    graphql_query_for(:package, { id: package_global_id }, <<~FIELDS)
+    #{all_graphql_fields_for('PackageDetailsType', max_depth: depth, excluded: excluded)}
+    packageFiles {
+      nodes {
+        #{package_files}
+        fileMetadata {
+          #{package_files_metadata}
+        }
+      }
+    }
+    FIELDS
+  end
+
+  subject { post_graphql(query, current_user: user) }
+
+  before do
+    subject
+  end
+
+  it_behaves_like 'a package detail'
+  it_behaves_like 'a package with files'
+
+  it 'has the correct file metadata' do
+    expect(first_file_response_metadata).to include(
+      'channel' => first_file.helm_file_metadatum.channel
+    )
+    expect(first_file_response_metadata['metadata']).to include(
+      'name' => first_file.helm_file_metadatum.metadata['name'],
+      'home' => first_file.helm_file_metadatum.metadata['home'],
+      'sources' => first_file.helm_file_metadatum.metadata['sources'],
+      'version' => first_file.helm_file_metadatum.metadata['version'],
+      'description' => first_file.helm_file_metadatum.metadata['description'],
+      'keywords' => first_file.helm_file_metadatum.metadata['keywords'],
+      'maintainers' => first_file.helm_file_metadatum.metadata['maintainers'],
+      'icon' => first_file.helm_file_metadatum.metadata['icon'],
+      'apiVersion' => first_file.helm_file_metadatum.metadata['apiVersion'],
+      'condition' => first_file.helm_file_metadatum.metadata['condition'],
+      'tags' => first_file.helm_file_metadatum.metadata['tags'],
+      'appVersion' => first_file.helm_file_metadatum.metadata['appVersion'],
+      'deprecated' => first_file.helm_file_metadatum.metadata['deprecated'],
+      'annotations' => first_file.helm_file_metadatum.metadata['annotations'],
+      'kubeVersion' => first_file.helm_file_metadatum.metadata['kubeVersion'],
+      'dependencies' => first_file.helm_file_metadatum.metadata['dependencies'],
+      'type' => first_file.helm_file_metadatum.metadata['type']
+    )
+  end
+end